Skip to content
PepMax
Shop
PeptidesPeptide BlendsSupplies
QualityAboutContact Us
Browse Catalog
  • Shop
  • Quality
  • About
  • Contact
Quick Links
  • FAQ
  • Terms
  • Privacy
For Research Use Only — All products for in vitro laboratory research. Not for human consumption.Read Disclaimer
PepMax

Research-grade peptides and laboratory compounds. Third-party tested. COA included with every order.

256-bit SSL
United States
Products
  • Full Catalog
  • Peptides
  • Peptide Blends
  • Supplies
Quality
  • Testing Methods
  • COA Library
  • Storage Guide
Support
  • FAQ
  • Contact
  • Shipping
  • Returns
  • Referrals
Legal
  • Disclaimer
  • Terms
  • Privacy

Research Use Only — All products sold on this website are intended for research and identification purposes only. These products are not intended for human dosing, injection, or ingestion.

FDA Disclaimer — These statements have not been evaluated by the Food and Drug Administration. These products are not intended to diagnose, treat, cure, or prevent any disease.

© 2026 PepMax LLC. All rights reserved.TermsPrivacyDisclaimer
HomeShopCartQualityAccount
Cart
Your cart is empty
Subtotal$0.00
View Cart
  1. Home
  2.  / Research
  3.  / Compound Profiles
  4.  / Tesamorelin (Egrifta): Compound Profile
Compound Profiles · 13 min read

Tesamorelin (Egrifta): Compound Profile

A scientific profile of tesamorelin (TH9507) — a synthetic 44-amino-acid GHRH analog and the only FDA-approved peptide in the PepMax catalog. Mechanism, the pivotal Phase 3 trials in HIV-associated lipodystrophy, the Lancet HIV NAFLD trial, the Egrifta / Egrifta SV / Egrifta WR formulation history, and the constraints that govern off-label use.

By PepMax Research TeamPublished May 3, 2026
  1. At a glance
  2. What tesamorelin is
  3. Mechanism
  4. Evidence map
  5. Pivotal Phase 3 — HIV lipodystrophy
  6. HIV-associated NAFLD
  7. Cognitive function (non-HIV)
  8. Safety profile
  9. Egrifta, Egrifta SV, Egrifta WR
  10. Development and approval timeline
  11. Limitations of the evidence base
  12. Off-label use, IGF-1, and what the label actually requires
  13. Reconstitution & handling
  14. Further reading
Key takeaways

Key takeaways

  • Tesamorelin is a synthetic 44-amino-acid analog of human growth hormone–releasing hormone (hGRF 1–44) with a trans-3-hexenoic acid attached to the N-terminal tyrosine. The N-terminal modification confers resistance to dipeptidyl peptidase-IV (DPP-IV) cleavage, prolonging plasma half-life relative to native GHRH and enabling once-daily subcutaneous dosing.
  • It is the only FDA-approved peptide in the PepMax catalog. Original Egrifta (F1 formulation) was approved on November 10, 2010 for reduction of excess visceral abdominal fat in adults with HIV and lipodystrophy. Egrifta SV (F4) was approved in 2019 and Egrifta WR (F8 formulation) was approved on March 25, 2025 — daily injection, weekly reconstitution; bioequivalent to F1 by PK; patent-protected through 2033.
  • The pivotal Phase 3 program (Falutz NEJM 2007; long-term data Falutz JAIDS 2010 and pooled JCEM 2010, n ≈ 806) showed selective ≈ 15–17% reduction in visceral adipose tissue without depleting subcutaneous fat, and improved triglycerides. Benefit reverses on withdrawal.
  • In HIV-associated NAFLD, the Lancet HIV 2019 pivotal randomized 12-month trial (Stanley et al.) reported an absolute −4.1% reduction in hepatic fat fraction (≈ 37% relative) and reduced fibrosis progression on biopsy. A Theratechnologies Phase 3 program in non-HIV NASH/MASH has been announced; no completed Phase 3 outcome data outside HIV exists as of 2026.
  • On-target IGF-1 elevation is expected and label-monitored; small but real increases in fasting glucose and HbA1c occur. Active malignancy is a contraindication. Tesamorelin is sold by PepMax under the slug "tesamorelin" — for laboratory research use only — and any human clinical use is governed by the Egrifta WR FDA label and prescribing physician.

Tesamorelin occupies a unique position in the PepMax catalog: it is the only molecule we ship that has been approved by the U.S. Food and Drug Administration for a human therapeutic indication. The original Egrifta was approved in November 2010, the twice-concentrated Egrifta SV in 2019, and the current commercial product Egrifta WR (an eight-times-concentrated F8 formulation that requires only weekly reconstitution) in March 2025[12][13]. The compound has a fully published Phase 3 program, a Lancet HIV pivotal NAFLD trial, an FDA prescribing label, and a 15-year post-marketing safety record. None of those facts is true of any other peptide in the catalog.

That regulatory legitimacy is also the source of a constraint. Tesamorelin’s approved indication is narrow: reduction of excess visceral abdominal fat in adults with HIV and lipodystrophy. Off-label interest — cognitive performance, non-HIV NAFLD/MASH, body recomposition in healthy adults — runs ahead of the data, and the label-defined safety constraints (active-malignancy contraindication, IGF-1 monitoring, glucose surveillance) apply regardless of indication. This profile is an attempt to describe what the molecule is, what the controlled clinical record actually shows, and where the popular framing departs from the published evidence.

Nothing in this article is a recommendation. Tesamorelin is supplied by PepMax under the slug tesamorelin for laboratory research use only. Human clinical use is governed by the Egrifta WR FDA prescribing information[12] and a prescribing physician.

At a glance

Sequence and structural details derive from the original Theratechnologies non-clinical pharmacology paper[11] and the FDA Egrifta WR label[12].

Compound data sheet

Tesamorelin

TH9507 · Egrifta · Egrifta SV · Egrifta WR · CAS 901758-09-6
Class
Synthetic 44-amino-acid analog of human GHRH (hGRF 1–44)
Modification
trans-3-hexenoic acid attached to the N-terminal Tyr¹
The N-terminal modification confers resistance to dipeptidyl peptidase-IV (DPP-IV) cleavage and substantially extends plasma half-life relative to native GHRH.
Sequence
(trans-3-hexenoyl)-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
C-terminally amidated 44-residue analog of native human GHRH(1–44).
Molecular weight
≈ 5 135.9 Da (free base; tesamorelin acetate is the marketed salt)
Receptor / target
Pituitary GHRH receptor (GHRH-R) — selective agonist
cAMP/PKA signalling in somatotrophs → pulsatile endogenous GH release → hepatic IGF-1 elevation.
Approved indication
Reduction of excess visceral abdominal fat in adults with HIV and lipodystrophy
No other FDA-approved indications. All other uses (HIV-NAFLD, cognitive function, non-HIV MASH, body composition) are off-label.
Approved dose
2 mg subcutaneously once daily
Highest published phase
FDA approved (2010, 2019, 2025)
Original Egrifta November 10, 2010; Egrifta SV 2019; Egrifta WR March 25, 2025. Lancet HIV NAFLD pivotal trial published December 2019.
Patent protection
Egrifta WR — protected through 2033
Per Theratechnologies disclosures associated with the F8 formulation.
WADA status
Prohibited at all times under section S2 (Peptide Hormones, GH Releasers)
GHRH analogs and growth-hormone secretagogues are prohibited in- and out-of-competition.

What tesamorelin is

Tesamorelin is a synthetic peptide originally developed by Theratechnologies under the designation TH9507. It is structurally an analog of human growth-hormone-releasing hormone (GHRH), specifically the 44-amino-acid native form hGRF(1–44), modified by attaching a trans-3-hexenoic acid at the N-terminal tyrosine. The modification matters: native GHRH is rapidly cleaved by dipeptidyl peptidase-IV (DPP-IV) at the Tyr¹–Ala² bond, producing a near-immediately inactive metabolite. The hexenoyl group blocks DPP-IV access, extending the in-vivo half-life enough to make once-daily subcutaneous dosing biologically meaningful[11][14].

Mechanistically, tesamorelin is a selectiveGHRH-receptor agonist — meaning it does not act through the ghrelin / GHS-R1a (growth-hormone secretagogue receptor) pathway used by compounds like ipamorelin, MK-677 (ibutamoren), and other ghrelin mimetics. The two pathways converge on pituitary growth-hormone release but differ in their pulsatility profile, IGF-1 dynamics, and side-effect signatures.

Naming clarification
“Tesamorelin,” “TH9507,” and “Egrifta” refer to the same molecule at different stages of its development pathway. Egrifta (F1), Egrifta SV (F4), and Egrifta WR (F8) are formulation generations of the same active ingredient. They are not different drugs.

Mechanism

Tesamorelin binds the pituitary GHRH receptor on somatotrophs and activates cAMP/PKA signalling, leading to pulsatile release of endogenous growth hormone. The resulting GH pulse drives hepatic production of insulin-like growth factor 1 (IGF-1), which is the systemic mediator of most downstream metabolic effects. Critically, the physiological pulsatility of GH release is preserved — tesamorelin amplifies the endogenous rhythm rather than producing a sustained supraphysiological elevation. This is the rationale for IGF-1 elevation that is meaningful but bounded, rather than the unbounded elevation seen with exogenous recombinant human GH[11][12].

TesamorelinGHRH analog (TH9507)Pituitary GHRH-RcAMP / PKA in somatotrophsPulsatile GH releasephysiological rhythm preservedHepatic IGF-1 ↑systemic mediatorVAT ↓ 15–17%SAT preservedHepatic fat ↓−4.1% absolute (HIV-NAFLD)TG ↓improved lipid profile
Pathway reported in Phase 3 programDownstream measured effect
Figure 1. Tesamorelin mechanism: selective GHRH-receptor agonism on pituitary somatotrophs drives pulsatile GH release, which elevates hepatic IGF-1. The downstream effects on visceral adipose tissue, liver fat, and lipid profile follow from this central axis.

Evidence map

The figure below summarizes the published tesamorelin evidence base by domain. Two domains carry the bulk of the regulatory weight: HIV-associated lipodystrophy (the approved indication) and HIV-associated NAFLD (the strongest off-label signal). All other domains are sparser.

Tesamorelin evidence map by domain
  • HIV-associated lipodystrophy (visceral adiposity)
    Two pivotal Phase 3 RCTs + 52-week safety extension; FDA-approved indication
    Approved
    Selective ≈15–17% reduction in VAT without depleting SAT; improved triglycerides and metabolic profile. Benefit reverses on withdrawal. The basis for FDA approval (2010, 2019, 2025).
  • HIV-associated NAFLD
    Lancet HIV 2019 multicentre RCT (12 months, paired biopsies)
    Phase 3
    Hepatic fat fraction reduced by an absolute −4.1% (≈37% relative) vs placebo; reduced fibrosis progression on biopsy. Off-label use; not an FDA-approved indication.
  • Hepatic transcriptomic / proteomic mechanism
    JCI Insight 2020 / Sci Rep 2021 — paired biopsy substudies
    Phase 2
    Tesamorelin upregulated oxidative phosphorylation and downregulated inflammation/TGF-β/tissue-repair gene sets; declines in plasma TGFB1 and CSF1 correlated with improved fibrosis-related gene scores.
  • Cognitive function (non-HIV)
    Baker 2012 — 20-week RCT, n=137, MCI and healthy older adults
    Phase 2
    Modest executive-function gains with 1 mg/day tesamorelin and ≈117% rise in IGF-1. Single trial, not replicated in a Phase 3 program.
  • Non-HIV NASH / MASH
    No human data
    Theratechnologies has publicly announced intent to advance the F8 formulation into general-population NASH/MASH Phase 3, but no completed Phase 3 RCT in non-HIV MASH/NAFLD existed as of 2026.
  • Cardiovascular outcomes
    Mixed / unclear
    Improvements in triglycerides and adiponectin observed in HIV trials; no powered cardiovascular-outcomes trial has been completed.
  • Body composition / anti-aging in healthy adults
    No human data
    No adequately powered randomized outcome data. Use in this setting is off-label; label-defined safety constraints apply regardless.
  • Long-term safety
    Approved
    Post-marketing record since November 2010; FDA label warns about glucose intolerance and contraindicates active malignancy. Periodic IGF-1 monitoring is required.

Pivotal Phase 3 — HIV lipodystrophy

Falutz and colleagues (2007) randomized 412 HIV patients with abdominal fat accumulation 2:1 to tesamorelin 2 mg/day or placebo for 26 weeks. Tesamorelin selectively reduced visceral adipose tissue (≈ 15–17% vs placebo) with preserved subcutaneous fat, and improved triglycerides. The result was published in the New England Journal of Medicine[1]. The 2010 JAIDS extension confirmed efficacy and safety over 52 weeks and demonstrated that benefit reversed when tesamorelin was withdrawn[2]. The pooled analysis of the two pivotal Phase 3 trials (Falutz JCEM 2010, n ≈ 806) consolidated the VAT reduction finding[3]. Stanley and colleagues (2012) reported that the visceral adiposity reduction was associated with an improved metabolic profile[8]. These four papers are the regulatory substrate of the original 2010 FDA approval and the subsequent SV and WR approvals.

HIV-associated NAFLD

Stanley and colleagues (2014) published the first JAMA randomized evidence that 6 months of tesamorelin reduced hepatic lipid in HIV-infected adults with abdominal fat accumulation (median −2.0% vs +0.9% placebo, p = 0.003)[4]. The pivotal trial in the indication, published in The Lancet HIVin December 2019, was a 12-month multicentre randomized double-blind placebo-controlled trial with paired liver biopsies: tesamorelin reduced hepatic fat fraction by an absolute −4.1% (approximately 37% relative reduction) and reduced fibrosis progression on biopsy[5]. Subsequent mechanistic substudies (Fourman 2020 JCI Insight, 2021 Scientific Reports) showed upregulation of oxidative-phosphorylation gene sets, downregulation of inflammation and TGF-β / tissue-repair signatures, and declines in plasma TGFB1 and CSF1 that correlated with improved fibrosis-related scores[6][7]. Stanley 2017 separately documented that VAT reduction with tesamorelin was associated with improved liver enzymes[9].

HIV-NAFLD vs general MASH/MASLD — a real distinction
The Lancet HIV trial is the strongest off-label evidence for tesamorelin in liver disease, but it is in HIV-associated NAFLD specifically. Translating those findings to general-population MASH/MASLD requires a separate Phase 3 program. As of 2026 a Theratechnologies general-population Phase 3 has been announced; no completed Phase 3 outcome data outside HIV exists.

Cognitive function (non-HIV)

Baker and colleagues (2012) conducted a 20-week randomized controlled trial of tesamorelin (1 mg/day) in 137 older adults including those with mild cognitive impairment, published in Archives of Neurology. The trial reported favorable effects on executive function with an approximately 117% rise in IGF-1[10]. This is a single trial with a relatively small sample, has not been replicated, and has not advanced to a registration program. It supports treating tesamorelin’s cognitive signal as hypothesis-generating rather than established.

Safety profile

Across the pivotal program and the post-marketing record, the dominant safety observations are:

  • IGF-1 elevation— on-target and label-monitored. The Egrifta WR label requires periodic IGF-1 monitoring with a defined ceiling above which dose interruption or discontinuation is indicated[12].
  • Glucose intolerance— small but real increases in fasting glucose and HbA1c are seen in clinical trials and are reflected in the FDA label as a warning. Pre-existing diabetes warrants particular attention[3][12].
  • Active malignancy— contraindicated. The IGF-1 axis and tumor biology are not separable.
  • Injection-site reactions— the most common adverse event in the pivotal trials (erythema, pruritus, pain).
  • Arthralgias and peripheral edema— consistent with GH-axis biology and reported in the pivotal trials[1][14].

Egrifta, Egrifta SV, Egrifta WR

Three commercial formulations of tesamorelin have been approved by the FDA. They are the same active ingredient at different concentrations and reconstitution profiles.

  • Egrifta (F1)— original 2010 approval. Daily injection, daily reconstitution.
  • Egrifta SV (F4)— 2019 approval. Twice-concentrated formulation, daily reconstitution.
  • Egrifta WR (F8)— March 25, 2025 approval. Eight-times concentrated vs original Egrifta; daily injection but only weekly reconstitution. Demonstrated bioequivalent to F1 by pharmacokinetic studies and patent-protected through 2033. This is the current U.S. commercial product[13].

Egrifta SV experienced a U.S. supply disruption in early 2025 following a 2024 contract-manufacturer shutdown; supply was restored after FDA approved a Prior Approval Supplement on April 8, 2025, during the WR transition[13].

Development and approval timeline

Selected milestones in the tesamorelin record
  1. 1999–2006TH9507 development at Theratechnologies
    Synthesis of the hexenoyl-modified GHRH analog; non-clinical pharmacology and safety package established.
  2. 2007Falutz NEJM — first Phase 3 readout
    412-patient pivotal trial demonstrates selective VAT reduction with 2 mg/day for 26 weeks.
  3. 2010Pivotal long-term and pooled Phase 3 data
    Falutz JAIDS 52-week extension and Falutz JCEM pooled analysis (n ≈ 806) consolidate the regulatory package.
  4. November 10, 2010FDA approval — Egrifta (F1)
    Approved for reduction of excess visceral abdominal fat in adults with HIV and lipodystrophy.
  5. 2012Baker 2012 — cognitive RCT
    Archives of Neurology: 20-week RCT in 137 older adults reports favorable executive-function effects.
  6. 2014Stanley JAMA — first liver-fat reduction in HIV
    First randomized evidence of reduced hepatic lipid with 6 months of tesamorelin.
  7. 2019Egrifta SV (F4) approval
    FDA approval of the twice-concentrated SV formulation.
  8. December 2019Stanley Lancet HIV — pivotal NAFLD trial
    12-month multicentre RCT with paired biopsies: hepatic fat fraction −4.1% absolute, reduced fibrosis progression.
  9. 2020–2021Hepatic mechanism papers
    Fourman JCI Insight 2020 and Scientific Reports 2021 characterize transcriptomic and proteomic responses in HIV-NAFLD.
  10. 2025Egrifta WR (F8) approval
    March 25, 2025: FDA approval of the eight-times-concentrated F8 formulation. Daily injection, weekly reconstitution. Bioequivalent to F1; patent-protected through 2033.
  11. 2026Status today
    Egrifta WR is the current U.S. commercial product. A general-population NASH/MASH Phase 3 has been announced; no completed Phase 3 outcome data outside HIV exists.

Limitations of the evidence base

  • Indication-specific evidence. The pivotal Phase 3 program is in HIV-associated lipodystrophy. The strongest off-label signal (HIV-NAFLD) is also in the HIV setting. Translating to non-HIV populations requires a separate program; the announcement of one does not substitute for the data.
  • Cognitive trial is unreplicated. Baker 2012 is the single peer-reviewed cognitive trial of any size in non-HIV populations. It has not been followed by a Phase 3 program and should be treated as hypothesis-generating.
  • No cardiovascular outcomes trial. The lipid and adiponectin improvements in the HIV trials are surrogate endpoints. A powered CVOT for tesamorelin has not been completed.
  • IGF-1 ceilings, not floors, are the safety frame.Researchers interpreting tesamorelin’s mechanism should remember that the label-defined safety constraint is keeping IGF-1 below a ceiling, not driving it as high as possible.
  • Body recomposition data is absent.The popular off-label use case — healthy-adult body composition or “anti-aging” — is not supported by adequate randomized outcome data. Effects on VAT in HIV-lipodystrophy do not extrapolate to healthy adult body recomposition without a controlled trial in that population.

Off-label use, IGF-1, and what the label actually requires

Tesamorelin is the rare peptide where off-label discussion has to defer to a real FDA prescribing label rather than to a vacuum. The Egrifta WR label is explicit about three things every researcher considering off-label work should internalize:

  • Periodic IGF-1 monitoring is required, with a defined ceiling for dose interruption or discontinuation.
  • Active malignancy is a contraindication. The reasoning is on-target IGF-1 biology.
  • Glucose intolerance is a labeled warning. Pre-existing diabetes warrants particular attention.

These constraints are not specific to the approved indication; they are properties of the molecule. Off-label work in non-HIV NAFLD, cognition, or body composition does not suspend the IGF-1, malignancy, or glucose constraints — it concentrates them in a population where the efficacy evidence is weaker.

Reconstitution & handling

Tesamorelin is supplied as a lyophilized powder. The Egrifta WR commercial formulation is reconstituted weekly and dosed daily; lyophilized research-grade powder shipped by PepMax should be handled like any peptide of comparable molecular weight. Reconstitute with bacteriostatic water (0.9% benzyl alcohol) for multi-day storage in solution, or sterile water for injectionwhen the bacteriostatic preservative is undesirable for a given research design. Mix gently; do not vortex. Store the lyophilized vial at −20 °C or below, protected from light and moisture; once reconstituted, refrigerate (2–8 °C) and use within the protocol-defined window. Avoid repeated freeze–thaw cycles.

For background on the analytical numbers on a peptide’s certificate of analysis — HPLC purity, mass-spectrometric identity confirmation, water content — see our companion methods articles on what ≥99% purity actually means and how we verify peptide purity.

Further reading

The bibliography below points to the primary papers and regulatory documents referenced in this profile. The Falutz 2007 NEJM paper[1] and the Stanley 2019 Lancet HIV paper[5] are the highest-yield primary readings; the Egrifta WR FDA label[12] is the operational document for any clinical use.

Available from PepMax

Tesamorelin

Tesamorelin is supplied by PepMax for laboratory research use only. Each lot ships with the lot-specific COA — HPLC chromatogram, mass-spectrometric identity confirmation, and water content — referenced on the product page. Human clinical use of tesamorelin is governed by the Egrifta WR FDA prescribing information and a prescribing physician.

Purity ≥99%10mgLot-specific COA included
View product

References

  1. [1]Falutz, J., Allas, S., Blot, K., Potvin, D., Kotler, D., Somero, M., et al. (2007). Metabolic effects of a growth hormone–releasing factor in patients with HIV. New England Journal of Medicine doi:10.1056/NEJMoa072375 PMID:18057338
  2. [2]Falutz, J., Potvin, D., Mamputu, J. C., Assaad, H., Zoltowska, M., Michaud, S. E., et al. (2010). Effects of tesamorelin, a growth hormone-releasing factor, in HIV-infected patients with abdominal fat accumulation: a randomized placebo-controlled trial with a safety extension. Journal of Acquired Immune Deficiency Syndromes PMID:20101189
  3. [3]Falutz, J., Mamputu, J. C., Potvin, D., Moyle, G., Soulban, G., Loughrey, H., et al. (2010). Effects of tesamorelin (TH9507), a growth hormone-releasing factor analog, in HIV-infected patients with excess abdominal fat: a pooled analysis of two multicenter, double-blind placebo-controlled Phase 3 trials with safety extension data. Journal of Clinical Endocrinology & Metabolism PMID:20554713
  4. [4]Stanley, T. L., Feldpausch, M. N., Oh, J., Branch, K. L., Lee, H., Torriani, M., Grinspoon, S. K. (2014). Effect of tesamorelin on visceral fat and liver fat in HIV-infected patients with abdominal fat accumulation: a randomized clinical trial. JAMA doi:10.1001/jama.2014.8334 PMID:25038357
  5. [5]Stanley, T. L., Fourman, L. T., Feldpausch, M. N., Purdy, J., Zheng, I., Pan, C. S., et al. (2019). Effects of tesamorelin on non-alcoholic fatty liver disease in HIV: a randomised, double-blind, multicentre trial. The Lancet HIV doi:10.1016/S2352-3018(19)30338-8 PMID:31611038
  6. [6]Fourman, L. T., Stanley, T. L., Billingsley, J. M., Sui, S. J. H., Feldpausch, M. N., Boutin, A., et al. (2020). Effects of tesamorelin on hepatic transcriptomic signatures in HIV-associated NAFLD. JCI Insight PMID:32701508
  7. [7]Fourman, L. T., Billingsley, J. M., Agyapong, G., Ho Sui, S. J., Feldpausch, M. N., Purdy, J., et al. (2021). Delineating tesamorelin response pathways in HIV-associated NAFLD using a targeted proteomic and transcriptomic approach. Scientific Reports PMID:34006921
  8. [8]Stanley, T. L., Falutz, J., Marsolais, C., Morin, J., Soulban, G., Mamputu, J. C., et al. (2012). Reduction in visceral adiposity is associated with an improved metabolic profile in HIV-infected patients receiving tesamorelin. Clinical Infectious Diseases PMID:22495074
  9. [9]Stanley, T. L., Feldpausch, M. N., Oh, J., Branch, K. L., Adler, G. K., Torriani, M., Grinspoon, S. K. (2017). Visceral fat reduction with tesamorelin is associated with improved liver enzymes in HIV. AIDS PMID:28832410
  10. [10]Baker, L. D., Barsness, S. M., Borson, S., Merriam, G. R., Friedman, S. D., Craft, S., Vitiello, M. V. (2012). Effects of growth hormone-releasing hormone on cognitive function in adults with mild cognitive impairment and healthy older adults: results of a controlled trial. Archives of Neurology
  11. [11]Ferdinandi, E. S., Brazeau, P., High, K., Procter, B., Fennell, S., Dubreuil, P. (2007). Non-clinical pharmacology and safety evaluation of TH9507, a human growth hormone-releasing factor analogue. Basic & Clinical Pharmacology & Toxicology PMID:17214611
  12. [12]U.S. Food and Drug Administration (2025). EGRIFTA WR (tesamorelin for injection) — Full Prescribing Information. FDA / Theratechnologies Source
  13. [13]Theratechnologies Inc. (2025). Theratechnologies receives FDA approval for EGRIFTA WR (tesamorelin F8) to treat excess visceral abdominal fat in adults with HIV and lipodystrophy. Theratechnologies (press release, March 25, 2025) Source
  14. [14]National Institute of Diabetes and Digestive and Kidney Diseases (LiverTox) (2018). Tesamorelin — LiverTox: Clinical and Research Information on Drug-Induced Liver Injury. NCBI Bookshelf Source
  15. [15]CADTH Common Drug Review (2019). Clinical Review Report: Tesamorelin (Egrifta). Canadian Agency for Drugs and Technologies in Health Source
Author
PepMax Research Team · Editorial

PepMax Research Library articles are written and edited in-house against the primary literature cited in each piece. We document our analytical methods openly so readers can verify the underlying chemistry against the references provided rather than relying on author authority. Where a topic exceeds our internal expertise, we either commission external review or do not publish on it.

Related research

Comparisons

The GLP-1 Incretin Landscape: Approved and Late-Stage Therapeutics in 2026

A structured reading list of the modern incretin class — semaglutide, tirzepatide, retatrutide, CagriSema, survodutide, and orforglipron. Receptor pharmacology, the trials that established each compound, the headline weight and metabolic effects, and what each program does and does not yet establish.

Apr 30, 2026·17 min read
Methods & Quality

How We Verify Peptide Purity: HPLC, Mass Spec, and ISO 17025

A walkthrough of the analytical methods PepMax requires for every lot — what each technique measures, why we use accredited third-party labs, and how the results land in the COA you receive.

Apr 30, 2026·11 min read
Methods & Quality

What ≥99% Purity Actually Means in Peptide Research

Most vendors print "≥99% purity" on every product page. The number is meaningful only with a lot-specific COA, a stated method, and an understanding of what HPLC purity does — and does not — measure.

Apr 29, 2026·9 min read
FOR RESEARCH USE ONLY

This product is sold for in vitro laboratory research purposes only. Not a drug, supplement, or household product. Not intended for human consumption, therapeutic use, or veterinary use. Read the full disclaimer.